DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and gst-27

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:131 Identity:32/131 - (24%)
Similarity:59/131 - (45%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PTLVDNLFVIWETRAIVVYLVEQYGKDDSLYP-KDPQKQALINQRLYFDMGTLYDGIAKYFFPLL 116
            |.|..:.|.|.::.||..||.:|:|     |. |.|::||..:        .:.|....:...:.
 Worm    54 PVLSVDGFEIPQSAAINRYLAKQFG-----YAGKTPEEQAWTD--------AIVDQYKDFMVSIK 105

  Fly   117 RTGKPG----TQENLEKL---------NAAFDLLNNFLD--GQDYVAGNQLSVADIVILATVSTT 166
            ..||..    :.|.:.|:         :|.|.::|..|:  ...::.|:.|::|||||:..::|.
 Worm   106 EVGKASAAGKSAEEVGKIIQSDLVPARDAFFVIINKILEKSKSGFLVGDGLTIADIVIVECITTL 170

  Fly   167 E 167
            :
 Worm   171 D 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 8/20 (40%)
PLN02395 11..208 CDD:166036 32/131 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 19/95 (20%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 8/20 (40%)
PTZ00057 6..208 CDD:173353 32/131 (24%)
GST_C_Sigma_like 85..191 CDD:198301 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.