DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and Gstz1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:189 Identity:50/189 - (26%)
Similarity:89/189 - (47%) Gaps:22/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFV--GEQLEPWFVKINPQHTIPTL-VDNLFVIWE 64
            ||:...|..:..|.:.....|:::..:.:|...  |:|....|..:||...:|.| :|.:.:: :
Mouse     8 LYSYFRSSCSWRVRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIV-Q 71

  Fly    65 TRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPL--LRTGKPGTQEN- 126
            :.||:.|| |:......|.|:||||:|::  |:..|:      ||....||  |...|...||| 
Mouse    72 SLAIMEYL-EETRPIPRLLPQDPQKRAIV--RMISDL------IASGIQPLQNLSVLKQVGQENQ 127

  Fly   127 ----LEKLNAAFDLLNNFLDGQ--DYVAGNQLSVADIVILATVSTTEMVDFDLKKFPNV 179
                .:.:.:.|:.|...|...  .|..|:::|:||:.::..|:..|....||..:|.:
Mouse   128 MQWAQKVITSGFNALEKILQSTAGKYCVGDEVSMADVCLVPQVANAERFKVDLSPYPTI 186

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 18/73 (25%)
PLN02395 11..208 CDD:166036 47/181 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/101 (27%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 18/73 (25%)
maiA 7..211 CDD:273527 50/189 (26%)
Glutathione binding 14..19 1/4 (25%)