DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and GSTO2

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:215 Identity:49/215 - (22%)
Similarity:83/215 - (38%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTL-VDNLFVIWETR 66
            :|:|...|.:....:..||..:....:.:|.   .....|:...:|...||.| .....:|:|:.
Human    26 IYSMRFCPYSHRTRLVLKAKDIRHEVVNINL---RNKPEWYYTKHPFGHIPVLETSQCQLIYESV 87

  Fly    67 AIVVYLVEQY-GKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQENLE-K 129
            ....||.:.| |:  .|:|.||.::|  .|::..::......:.|.....||.|:..|  ||: .
Human    88 IACEYLDDAYPGR--KLFPYDPYERA--RQKMLLELFCKVPHLTKECLVALRCGRECT--NLKAA 146

  Fly   130 LNAAFDLLNNFLDGQD--YVAGNQLSVADIV------------ILATVSTTEMVDFDLKKFPNVD 180
            |...|..|...|:.|:  :..|..:|:.|.:            ||..||.|          |.:.
Human   147 LRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHT----------PALR 201

  Fly   181 RWYKNAQKVTPGWDENLARI 200
            .|. :|.|    ||..:..:
Human   202 LWI-SAMK----WDPTVCAL 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 15/71 (21%)
PLN02395 11..208 CDD:166036 46/207 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/128 (22%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 14/70 (20%)