Sequence 1: | NP_524915.1 | Gene: | GstD6 / 48339 | FlyBaseID: | FBgn0010042 | Length: | 215 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001274522.1 | Gene: | CLIC1 / 1192 | HGNCID: | 2062 | Length: | 241 | Species: | Homo sapiens |
Alignment Length: | 219 | Identity: | 50/219 - (22%) |
---|---|---|---|
Similarity: | 87/219 - (39%) | Gaps: | 46/219 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDLYNMSGS--------PSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVD 57
Fly 58 NLFVIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPG 122
Fly 123 TQENLEK-LNAAFDLLNNFLDG------------------QDYVAGNQLSVADIVILATVSTTEM 168
Fly 169 V-----DFDL-KKFPNVDRWYKNA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD6 | NP_524915.1 | GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 19/80 (24%) |
PLN02395 | 11..208 | CDD:166036 | 46/201 (23%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 29/124 (23%) | ||
CLIC1 | NP_001274522.1 | Required for insertion into the membrane | 2..90 | 20/90 (22%) | |
O-ClC | 6..241 | CDD:129941 | 50/219 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154488 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |