DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD6 and vars1

DIOPT Version :9

Sequence 1:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:160 Identity:41/160 - (25%)
Similarity:69/160 - (43%) Gaps:25/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VIWETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQE 125
            |:..|.|:..||.....:..|    |.::::.:.|.|.|....|........||||  |..|..:
Zfish    56 VLSGTSAVSWYLAATGKRAGS----DKKQESQVWQWLSFAENELTPVACAVAFPLL--GIMGVDK 114

  Fly   126 NLEKLNAAFDLLN--NFLDG----QDYVAGNQLSVADIVILATVSTTEMVDF-------DLKKFP 177
            .|::.:.| :||.  ..|||    :.::.|..:::||    |.|:...::.|       |.|...
Zfish   115 KLQQSSRA-ELLRVLKALDGTLALRTFLVGESVTLAD----AAVAMAALLPFKYALEPADRKSLV 174

  Fly   178 NVDRWYKNAQKVTPGWDENLARIQSAKKFL 207
            ||.||: |.....|.:.:.|.:|...:|.:
Zfish   175 NVTRWF-NTCVNQPQFLKVLGKISLCEKMV 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 5/12 (42%)
PLN02395 11..208 CDD:166036 41/160 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/128 (26%)
vars1NP_001298275.1 GstA <45..192 CDD:223698 38/147 (26%)
GST_C_ValRS_N 80..202 CDD:198327 33/129 (26%)
PTZ00419 291..1270 CDD:240411
ValRS_core 340..941 CDD:185677
tRNA-synt_1_2 518..643 CDD:290334
Anticodon_Ia_Val 941..1081 CDD:153416
Val_tRNA-synt_C 1203..1266 CDD:287436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.