DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTO1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:211 Identity:58/211 - (27%)
Similarity:90/211 - (42%) Gaps:46/211 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MVAKALGVK---LNMKLLNTLEKDQLKPE-FVKLNPQHTIPTLVDN-GFSIWESRAIAVYLVEKY 76
            :|.||.|::   :|:.|.|       ||| |.|.||...:|.|.:: |..|:||.....||.|.|
Human    40 LVLKAKGIRHEVININLKN-------KPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAY 97

  Fly    77 -GKDDTLFPKDPKKQALVNQRLYFDM--------GTLYDSFAKYYYPLFHTGKPGSDEDFKKIES 132
             ||  .|.|.||.::|.  |::..::        |:...|..|..|       .|..|:|:|   
Human    98 PGK--KLLPDDPYEKAC--QKMILELFSKVPSLVGSFIRSQNKEDY-------AGLKEEFRK--- 148

  Fly   133 SFEYLNIFLEGQ--NYVAGDHLTVADIAILSTVSTFEIFDFD--LNKYPNVARWYANAKKVTP-- 191
            .|..|...|..:  .:..|:.:::.|..|.......|....:  ::..|.:..|.| |.|..|  
Human   149 EFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMA-AMKEDPTV 212

  Fly   192 ----GWEENWKGAVEL 203
                ..|::|:|.:||
Human   213 SALLTSEKDWQGFLEL 228

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 49/184 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/61 (36%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/134 (21%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 21/60 (35%)