DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and CLIC3

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:176 Identity:40/176 - (22%)
Similarity:69/176 - (39%) Gaps:50/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY 76
            |:.:.||....||...:..::|.....:..:|.   |...:|.|:.:..:..::..|..:|.|..
Human    25 CQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFA---PGSQLPILLYDSDAKTDTLQIEDFLEETL 86

  Fly    77 GKDD----------------------TLFPKDP---KKQALVNQRLYFDMGTLYDSFAKYYYPLF 116
            |..|                      :.|.|:|   :.:||. |:|...:..| ||:.:  .||.
Human    87 GPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALY-QQLLRALARL-DSYLR--APLE 147

  Fly   117 H--TGKPGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAIL 160
            |  .|:|...|..::          ||:      ||.||:||.::|
Human   148 HELAGEPQLRESRRR----------FLD------GDRLTLADCSLL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 40/176 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 12/61 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/75 (29%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 13/65 (20%)
PLN02817 5..229 CDD:330276 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.