DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GTT1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:40/204 - (19%)
Similarity:73/204 - (35%) Gaps:65/204 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEFVKLNPQHTIP-------------TLVDNGFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQAL 92
            ||..|::|....|             .|.::||       |..|:::.:.....|..:|......
Yeast    45 PELKKIHPLGRSPLLEVQDRETGKKKILAESGF-------IFQYVLQHFDHSHVLMSEDADIADQ 102

  Fly    93 VNQRLYFDMGTLYDSFAKYY-----------YPLFHTGKPGSDEDFKKIESSFEYLN--IFLEGQ 144
            :|..|::..|:|.......:           :|:.:..:..:|: ..:..||.|..|  .|:||:
Yeast   103 INYYLFYVEGSLQPPLMIEFILSKVKDSGMPFPISYLARKVADK-ISQAYSSGEVKNQFDFVEGE 166

  Fly   145 -----NYVAGDHLTVADIAILSTVSTFEIFDFDL-----------NKYPNVARWYANAKKVTPGW 193
                 .|:....|:.|||          :..|.|           ..||.:::|   .|.:|.  
Yeast   167 ISKNNGYLVDGKLSGADI----------LMSFPLQMAFERKFAAPEDYPAISKW---LKTITS-- 216

  Fly   194 EENWKGAVE 202
            ||::..:.|
Yeast   217 EESYAASKE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 35/184 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 10/45 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/144 (19%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 10/48 (21%)
GST_C_GTT1_like 93..218 CDD:198298 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.