DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GTT2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:52/203 - (25%)
Similarity:84/203 - (41%) Gaps:28/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGS-GCRTVIMVA-KALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTL-VDNGFSI 62
            |..|.:|.|. ..|..|.:| |.:...:....:|..:.:..||||:..|...|:|.| :|:|..|
Yeast    19 MIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLI 83

  Fly    63 WESRAIAVYLVEKYGKDDTLFPKDPKKQALV---NQRLYFDMGTLYDSFAKYYYPLFHTGKPGSD 124
            .|..||..| ::......||..|.|.::.::   |:|...:   |.|..:.|    ||...||..
Yeast    84 AECTAITEY-IDALDGTPTLTGKTPLEKGVIHMMNKRAELE---LLDPVSVY----FHHATPGLG 140

  Fly   125 EDFK-------------KIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKY 176
            .:.:             |......|.:..|..:.|||||..::|||.:::.:....|....:.:.
Yeast   141 PEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIVKLQVPEE 205

  Fly   177 PNVAR-WY 183
            ....| ||
Yeast   206 CEALRAWY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 52/203 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/75 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/113 (21%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 24/75 (32%)
GST_C_GTT2_like 106..222 CDD:198291 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345131
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.