DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTF14

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:171 Identity:51/171 - (29%)
Similarity:74/171 - (43%) Gaps:34/171 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD--DTLFPKDPKKQALVNQRLYFD-------M 101
            |||...:|.|.|....::|.:||..||.|:| ||  ..|.|.||||:|:::..:..|       .
plant    51 LNPFGEVPVLEDGDLKLFEPKAITRYLAEQY-KDVGTNLLPDDPKKRAIMSMWMEVDSNQFLPIA 114

  Fly   102 GTLYDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLNIF---LEGQNYVAGDHLTVADIAILSTV 163
            .||........|....|......|:.:|:.   |.|||:   |....|:||:..::||:..|:.:
plant   115 STLIKELIINPYQGLATDDTAVQENKEKLS---EVLNIYETRLGESPYLAGESFSLADLHHLAPI 176

  Fly   164 STFEIFDFDLN-----------KYPNVARWYANAKKVTPGW 193
                  |:.||           ..||||.| ....|:.|.|
plant   177 ------DYLLNTDEEELKNLIYSRPNVAAW-VEKMKMRPAW 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 48/160 (30%)
GST_N_Delta_Epsilon 1..74 CDD:239343 11/27 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/127 (25%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 11/28 (39%)
GST_C_Phi 94..214 CDD:198296 32/127 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.