DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTF7

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_171791.1 Gene:GSTF7 / 839295 AraportID:AT1G02920 Length:209 Species:Arabidopsis thaliana


Alignment Length:204 Identity:45/204 - (22%)
Similarity:82/204 - (40%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVY 71
            |..:..|.|::......:......:...:.:..|..|:..||...:|...|..|.::|||||..|
plant    10 PASTATRRVLIALHEKNLDFEFVHIELKDGEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQY 74

  Fly    72 LVEKYGKDD----TLFPKDPKKQAL---VNQRLYFDMGT--LYDSFAKYYYPLFHTGKPGSDEDF 127
            :...|....    :|..||....|:   :....:..:|:  :::...|..|.: .|.|...:|:.
plant    75 IAHFYSDKGNQLVSLGSKDIAGIAMGIEIESHEFDPVGSKLVWEQVLKPLYGM-TTDKTVVEEEE 138

  Fly   128 KKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVS------TFEIFDFDLNKYPNVARWYA-- 184
            .|:....:.....|....|:|.|..|:.|:..:..:.      |.::||    :.|:|:.|.|  
plant   139 AKLAKVLDVYEHRLGESKYLASDKFTLVDLHTIPVIQYLLGTPTKKLFD----ERPHVSAWVADI 199

  Fly   185 ----NAKKV 189
                :||||
plant   200 TSRPSAKKV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 40/191 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/66 (24%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/119 (21%)
GSTF7NP_171791.1 GST_N_Phi 4..77 CDD:239351 16/66 (24%)
GST_C_Phi 95..209 CDD:198296 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.