DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTT3

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:203 Identity:51/203 - (25%)
Similarity:92/203 - (45%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY- 76
            |.|::..|...::.:..|:....:.||.|||..:||...:|.:||....:.||.||.:||...| 
plant    15 RAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSESHAILIYLSSAYP 79

  Fly    77 GKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYY----------YPLFHTGKPGSDEDFKKIE 131
            ...|..:|.|..|:|.::..|.:....|....|.|.          .||   ....:.|..:.:.
plant    80 SVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPL---NPKAAAEAEQLLT 141

  Fly   132 SSFEYLNIF-LEGQ-NYVAGDHL-TVADIAILSTVSTFEIFDFD-----LNKYPNVARWYANAKK 188
            .|...|:.| |:|. .::.|.:. ::||::::..::..::.|..     |:.:.||.:|..|.:|
plant   142 KSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSPHKNVEQWIENTRK 206

  Fly   189 VT-PGWEE 195
            .| |.::|
plant   207 ATMPHFDE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 46/189 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/60 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/127 (21%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 46/189 (24%)
GST_N_Theta 3..78 CDD:239348 20/62 (32%)
GST_C_Theta 92..221 CDD:198292 27/126 (21%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.