DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTT1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:218 Identity:54/218 - (24%)
Similarity:101/218 - (46%) Gaps:21/218 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY- 76
            |.||:..|..|::.:..|::..::.||.|||..:||...:|.:||....::||.||.:||...: 
plant    16 RAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKLFESHAILIYLSSAFP 80

  Fly    77 GKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYY----------YPLFHTGKPGSDEDFKKIE 131
            ...|..:|.|..|:|.::..|.:....|....|.|.          .||.......:::...|..
plant    81 SVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYVLNSVLGPALGLPLNPKAAAEAEQLLTKSL 145

  Fly   132 SSFEYLNIFLEGQ-NYVAGDHL-TVADIAILSTVSTFEIFDFD-----LNKYPNVARWYANAKKV 189
            |:.|  ..:|:|. .::.|.:. ::||::::..:...::.|..     |:.:..|.:|..|.||.
plant   146 STLE--TFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRLRLLSTHKKVEQWIENTKKA 208

  Fly   190 T-PGWEENWKGAVELKGVFDARQ 211
            | |.::|..:...::|..|..|:
plant   209 TMPHFDETHEILFKVKEGFQKRR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 45/188 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/60 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/133 (20%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 22/62 (35%)
GST_C_Theta 93..223 CDD:198292 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.