DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTF12

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:196 Identity:56/196 - (28%)
Similarity:84/196 - (42%) Gaps:38/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDT-LFPKDPKKQALVN 94
            |:|.|  |.|||.:...|...:|.:.|..|.::||||||.|...|:....| |..|..:.:|:|:
plant    35 LDTFE--QKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLLGKSLEHRAIVD 97

  Fly    95 QRLYFDMGTLYDSFAKYYYPLFHT--GKP--GSD------EDFK-KIESSFEYLNIFLEGQNYVA 148
            |  :.|:.|.|  |.....||...  .||  |..      ||.| |:....:..|..|....::|
plant    98 Q--WADVETYY--FNVLAQPLVINLIIKPRLGEKCDVVLVEDLKVKLGVVLDIYNNRLSSNRFLA 158

  Fly   149 GDHLTVADIAILSTVSTFEIFDFDLNKYPNVA----RWYANAKKVTPGWEE-----NWKGAVELK 204
            |:..|:||:..:..:. :.:...|:|:.....    ||          |||     :||..:.|.
plant   159 GEEFTMADLTHMPAMG-YLMSITDINQMVKARGSFNRW----------WEEISDRPSWKKLMVLA 212

  Fly   205 G 205
            |
plant   213 G 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 49/168 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/42 (43%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/135 (24%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 56/196 (29%)
GST_N_Phi 2..77 CDD:239351 18/43 (42%)
GST_C_Phi 91..209 CDD:198296 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.