DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTF2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:222 Identity:50/222 - (22%)
Similarity:74/222 - (33%) Gaps:67/222 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PRGSGCRTVIMVAKALGVK-LNMKLLNTLEKD--QLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            |.....|.|::   ||..| |:.:|::...||  ..|..|:..||...:|...|....::|||||
plant    10 PASIATRRVLI---ALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAI 71

  Fly    69 AVYLVEKYGKDDT-LFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIES 132
            ..|:..:|....| |...|.|.   ::|                 |.:...|....|..|..:.|
plant    72 TQYIAHRYENQGTNLLQTDSKN---ISQ-----------------YAIMAIGMQVEDHQFDPVAS 116

  Fly   133 SFEYLNIF------------------------------LEGQNYVAGDHLTVAD------IAILS 161
            ...:..||                              |:...|:||:..|:.|      |..|.
plant   117 KLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLL 181

  Fly   162 TVSTFEIFDFDLNKYPNVARWYANAKK 188
            ...|.::|    .:.|.|..|.|...|
plant   182 GTPTKKLF----TERPRVNEWVAEITK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 48/216 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/69 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 24/137 (18%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 22/70 (31%)
GST_C_Phi 96..211 CDD:198296 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.