DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:212 Identity:53/212 - (25%)
Similarity:87/212 - (41%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRGSGC-RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            |....|.| ..|::.......:..:..:|........|.|:.:||...:|.|.|:..:::|||||
plant     6 YGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFESRAI 70

  Fly    69 AVYLVEKY---GKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKI 130
            ..|:.||:   |.|.|.. :|||:.|:|......:......:.:...:.|......|...:...:
plant    71 TAYIAEKHRDKGTDLTRH-EDPKEAAIVKLWSEVEAHHFNPAISAVIHQLIVVPLQGESPNAAIV 134

  Fly   131 ESSFEYLNIFLE------GQ-NYVAGDHLTVADI-------AILSTVSTFEIFDFDLNKYPNVAR 181
            |.:.|.|...|:      |: .|:|||..|:||:       ..:.|:....|     |..|||..
plant   135 EENLENLGKILDVYEERLGKTKYLAGDTYTLADLHHVPYTYYFMKTIHAGLI-----NDRPNVKA 194

  Fly   182 WYANA------KKVTPG 192
            |:.:.      .||:||
plant   195 WWEDLCSRPAFLKVSPG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 49/196 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/69 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/125 (22%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 50/208 (24%)
GST_N_Phi 2..77 CDD:239351 18/70 (26%)
GST_C_Phi 92..208 CDD:198296 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.