DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTF11

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:220 Identity:56/220 - (25%)
Similarity:91/220 - (41%) Gaps:54/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MVAKALG-VKL---NMKLLNTLEKD--------------QLKPEFVKLNPQHTIPTLVDNGFSIW 63
            ||.|..| :|.   ...||..||||              |.||:.:...|...:|.:.|....::
plant     1 MVVKVYGQIKAANPQRVLLCFLEKDIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLF 65

  Fly    64 ESRAIAVYLVEKYGKDDT-LFPKDPKKQALVNQRLYFDMGTLYDSFAKYYY----PLF------- 116
            ||||||.|...||....| |..|..:.:|:|:|.:..:        ..|:|    ||.       
plant    66 ESRAIARYYATKYADQGTDLLGKTLEGRAIVDQWVEVE--------NNYFYAVALPLVMNVVFKP 122

  Fly   117 HTGKPGSDEDFKKIESSFE-YLNIF---LEGQNYVAGDHLTVADIA-------ILSTVSTFEIFD 170
            .:|||......::::..|: .|:::   |....|:.||..|:||::       |::..|...:  
plant   123 KSGKPCDVALVEELKVKFDKVLDVYENRLATNRYLGGDEFTLADLSHMPGMRYIMNETSLSGL-- 185

  Fly   171 FDLNKYPNVARWYANAKKVTPGWEE 195
              :....|:.||: |.....|.|::
plant   186 --VTSRENLNRWW-NEISARPAWKK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 53/207 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/74 (32%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/130 (21%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 56/220 (25%)
GST_N_Phi 2..77 CDD:239351 23/74 (31%)
GST_C_Phi 91..209 CDD:198296 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.