DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTF9

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:209 Identity:51/209 - (24%)
Similarity:89/209 - (42%) Gaps:26/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIA 69
            |.|..:..:..::.....||......::.::.:..:|.::.|.|..|:|.:||..:.|:||||:.
plant     6 YGPHFASPKRALVTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVM 70

  Fly    70 VYLVEKY---GKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIE 131
            .|:.|||   |.|  |..|..:.:..|.|.|..:..|.:.........:......|...|.|.|:
plant    71 RYVAEKYRSQGPD--LLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFPSDEKLIK 133

  Fly   132 SSFE----YLNIF---LEGQNYVAGDHLTVADIAILSTV--------STFEIFDFDLNKYPNVAR 181
            .|.|    .|:::   |....|:|||.:::||:|.|...        ..:.|.|     ..:|:.
plant   134 ESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKD-----RKHVSA 193

  Fly   182 WYANAKKVTPGWEE 195
            |:.:... .|.|:|
plant   194 WWDDISS-RPAWKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 48/196 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 17/68 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/123 (22%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 51/209 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.