DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Gstt4

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001103145.1 Gene:Gstt4 / 686922 RGDID:1591294 Length:240 Species:Rattus norvegicus


Alignment Length:173 Identity:40/173 - (23%)
Similarity:82/173 - (47%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ||...:|    ||.|.:.|:..|:..:.:.::.|:......|::::||...:|:|.|..|.:.||
  Rat     7 MDLLSAP----CRAVYIFARKNGIPFDFQFVDLLKGHHHSKEYIEINPLRKVPSLRDGKFILSES 67

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYY-----PLFHTGKPGSDE 125
            .||..||..||......:|.|...:|.|::.:.:....:....:|..:     |:.    .|.:.
  Rat    68 VAILCYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMI----TGEEV 128

  Fly   126 DFKKIESSFEYLN--------IFLEGQNYVAGDHLTVADIAIL 160
            ..::::.:.:.:|        .||:.:.::.|||:::||:..|
  Rat   129 PTERLDKTLDEVNKNIKQFEEKFLQDKLFITGDHISLADLVAL 171

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 40/173 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/72 (31%)
GST_C_Delta_Epsilon 88..204 CDD:198287 14/86 (16%)
Gstt4NP_001103145.1 GST_N_Theta 3..78 CDD:239348 22/74 (30%)