DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTT2B

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001074312.1 Gene:GSTT2B / 653689 HGNCID:33437 Length:244 Species:Homo sapiens


Alignment Length:185 Identity:47/185 - (25%)
Similarity:90/185 - (48%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |.|.:.||..|:.|.::.::.::......||:::|....:|||.|..|.:.||.||.:||..||.
Human    15 RAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAILIYLSCKYQ 79

  Fly    78 KDDTLFPKDPKKQALVNQRLYFDMGTLYDSF-----AKYYYPLFHTGKPGSDEDFKK----IESS 133
            ..|..:|.|.:.:|.|::.|.:....:..:|     .:...||.....|  :|..::    ::.:
Human    80 TPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVP--EEKVERNRTAMDQA 142

  Fly   134 FEYL-NIFLEGQNYVAGDHLTVADIAILSTVST-----FEIFDFDLNKYPNVARW 182
            .::| :.||..:.::||..:|:||:..|..:..     :|:|:    ..|.:|.|
Human   143 LQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFE----GRPRLAAW 193

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 47/185 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/60 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/110 (20%)
GSTT2BNP_001074312.1 GST_N_Theta 3..78 CDD:239348 20/62 (32%)