DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gstt1a

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:206 Identity:54/206 - (26%)
Similarity:97/206 - (47%) Gaps:26/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ::.|.......||:|.:.||...:....|.::....:|...||.|::....:|.|.|..|.:.||
Zfish     3 LELYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYY-----PLFHTGKPGSDE 125
            .||.:||..|:...|..:|.|.:|:|.|::.|.:....:....:|.::     |.. ||.|...|
Zfish    68 IAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHGSKVFWFKGVLPAV-TGAPVPKE 131

  Fly   126 DFKKIESSFEYLNI--------FLEGQNYVAGDHLTVADIA----ILSTVST-FEIFDFDLNKYP 177
               |::|:.|.||:        ||:.:.::.||.:::|||.    ::..|:| .::|:    ..|
Zfish   132 ---KMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVATGVDVFE----GRP 189

  Fly   178 NVARWYANAKK 188
            .::.|....||
Zfish   190 ALSAWRDRVKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 52/200 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/119 (24%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 52/203 (26%)
GST_N_Theta 3..78 CDD:239348 21/74 (28%)
GST_C_Theta 91..217 CDD:198292 29/118 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.