Sequence 1: | NP_524914.3 | Gene: | GstD5 / 48338 | FlyBaseID: | FBgn0010041 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_061845.2 | Gene: | GDAP1 / 54332 | HGNCID: | 15968 | Length: | 358 | Species: | Homo sapiens |
Alignment Length: | 251 | Identity: | 47/251 - (18%) |
---|---|---|---|
Similarity: | 87/251 - (34%) | Gaps: | 84/251 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD 79
Fly 80 DTLFPK-DPKKQALVNQRL--YFDMGTLYDSFAKYYY----------------PLFHTGK----- 120
Fly 121 PGSDEDFKKI------------------------ESSFEYLNIFL-------------------- 141
Fly 142 ---EGQN-YVAGDHLTVADIAILSTVSTFEIFDF-----DLNKYPNVARWYANAKK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD5 | NP_524914.3 | GstA | 1..184 | CDD:223698 | 45/245 (18%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 16/58 (28%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 28/177 (16%) | ||
GDAP1 | NP_061845.2 | GST_N_GDAP1 | 26..98 | CDD:239350 | 15/57 (26%) |
GST_C_GDAP1 | 179..289 | CDD:198336 | 17/107 (16%) | ||
Required for mitochondrial localization | 320..358 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154501 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |