DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Gstt3

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:197 Identity:49/197 - (24%)
Similarity:92/197 - (46%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ::.|.......||.|.:.||..|:...::.:..|:.......|.::||...:|.|.|..|.:.||
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYD-----SFAKYYYPLFHTGKPGSDE 125
            .||.:||..||...|..:|:|.:.:|.|::.|.:....|..     .:.|..:|:| .|:|...|
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVF-LGQPVPPE 188

  Fly   126 ----DFKKIESSFEYL-NIFLEGQNYVAGDHLTVADIAILSTV-----STFEIFDFDLNKYPNVA 180
                ...:::...:.| :.||:.:.::.|.|::|||:..::.:     :..:||:    ..|.:|
  Rat   189 RLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIFE----SRPKLA 249

  Fly   181 RW 182
            .|
  Rat   250 AW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 49/197 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/110 (21%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 21/74 (28%)
GST_C_Theta 149..273 CDD:198292 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348111
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.650

Return to query results.
Submit another query.