DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:201 Identity:54/201 - (26%)
Similarity:89/201 - (44%) Gaps:31/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEK-DQLKPEFVKLNPQHTIPTLVDNGFSIWE 64
            :|....|    ||:|.:.|||..:..|...|..|:. :.|..||.|::..|.:|.|.|..|::.|
 Frog    10 LDLLSQP----CRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGNFTMAE 70

  Fly    65 SRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYY-----PLFHTGKPGSD 124
            |.|:.:||..||...:..:|.|.:|:|.|::.|.:.........:|.::     |.. .||....
 Frog    71 STAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTI-LGKEVPS 134

  Fly   125 EDFKKIESSF-----EYLNIFLEGQNYVAGDHLTVADI--------AILSTVSTFEIFDFDLNKY 176
            |....:.:.|     .:...||..:.::|||.::|||:        .|.|.|:.||       :.
 Frog   135 EKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFE-------ER 192

  Fly   177 PNVARW 182
            |.:..|
 Frog   193 PKLGSW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 54/201 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/73 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/113 (22%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 25/75 (33%)
GST_C_Theta 95..221 CDD:198292 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.