DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and clic5a

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:208 Identity:47/208 - (22%)
Similarity:75/208 - (36%) Gaps:60/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVE----- 74
            :.|:....||..|   :.|::..:...:...|.|....|.|..||....:...|..:|.|     
Zfish    34 LFMILWLKGVVFN---VTTVDLKRKPADLHNLAPGTPPPFLTFNGEVRTDVNKIEEFLEEMLAPP 95

  Fly    75 KYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDED--------FKKIE 131
            ||.|   |..|:.:.....|           |.|||:...:.:| ||.::..        .||::
Zfish    96 KYPK---LAAKNKESNTAGN-----------DIFAKFSAYIKNT-KPEANASLEKGLLKVLKKLD 145

  Fly   132 SSFEYLNIFL--------------EGQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPN---- 178
            |   :||..|              ..:.|:.|:.||:||..:|..:...::..   .||.|    
Zfish   146 S---FLNSPLPDEIDAESTGEEKSSNRKYLDGNELTLADCNLLPKLHVVKVVS---KKYRNFEIP 204

  Fly   179 -----VARWYANA 186
                 |.|:..||
Zfish   205 SDLSGVWRYLQNA 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 45/204 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/58 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/130 (22%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 14/65 (22%)
O-ClC 10..244 CDD:129941 47/208 (23%)
GST_C_CLIC5 104..244 CDD:198330 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.