DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gsto1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:181 Identity:47/181 - (25%)
Similarity:80/181 - (44%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MVAKALGVK---LNMKLLNTLEKDQLKPE-FVKLNPQHTIPTL-VDNGFSIWESRAIAVYLVEKY 76
            :|..|.|:|   :|:.|.|       ||: |::.||...:|.| ..:|..|:||.....||.|.|
Zfish    39 LVLNAKGIKYDTININLKN-------KPDWFLEKNPLGLVPVLETQSGQVIYESPITCEYLDEVY 96

  Fly    77 GKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYY--PLFHTGKPGSDEDFKKIESSF----- 134
             .:..|.|.||.::|  .||:..:   |:.....|:|  |:..|    ..||...:|:..     
Zfish    97 -PEKKLLPFDPFERA--QQRMLLE---LFSKVTPYFYKIPVNRT----KGEDVSALETELKDKLS 151

  Fly   135 EYLNIFLEGQN-YVAGDHLTVADIAILSTVSTFEIFDFD--LNKYPNVARW 182
            ::..|.|:.:: :..||.:|:.|..:.......|..:..  |:..|.:.:|
Zfish   152 QFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGTPELKKW 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 47/181 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/61 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/105 (20%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 19/60 (32%)
GstA 25..210 CDD:223698 47/181 (26%)
GST_C_Omega 107..229 CDD:198293 21/105 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.