DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and clic2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:200 Identity:49/200 - (24%)
Similarity:86/200 - (43%) Gaps:44/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRTVIMVAKALGVKLNMKLLNTLEK-DQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEK 75
            |:.:.||....|||..:..::..:| |:||......||    |.|:.||....:...|..:|   
Zfish    32 CQRLFMVLWLKGVKFTVTTVDMRKKPDELKDLAPGTNP----PFLLYNGTLKTDFIKIEEFL--- 89

  Fly    76 YGKDDTLFPKDPKKQAL-VNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSD-------EDFKKIES 132
               :.||.|  |:...| ...:..||:|.  |.|||  :..|....|.:.       .:||::: 
Zfish    90 ---ETTLAP--PRYPHLSPRYKESFDVGA--DIFAK--FSAFIKNSPNNAFHEKALLREFKRLD- 144

  Fly   133 SFEYL----------NIFLEGQNYVAGDHLTVADIAILSTVSTFEI-----FDFDL-NKYPNVAR 181
              :||          ||.:..:.::.|:.||:||..:|..:...::     .:||: .::..|.|
Zfish   145 --DYLNTPLQDELDQNISVSKRKFLDGNRLTLADCNLLPKLHVIKVAARKYCNFDIPTQFTGVWR 207

  Fly   182 WYANA 186
            :..:|
Zfish   208 YLQSA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 48/196 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 18/62 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/122 (21%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 48/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589553
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.