Sequence 1: | NP_524914.3 | Gene: | GstD5 / 48338 | FlyBaseID: | FBgn0010041 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002561.2 | Gene: | clic2 / 436834 | ZFINID: | ZDB-GENE-040718-299 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 86/200 - (43%) | Gaps: | 44/200 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 CRTVIMVAKALGVKLNMKLLNTLEK-DQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEK 75
Fly 76 YGKDDTLFPKDPKKQAL-VNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSD-------EDFKKIES 132
Fly 133 SFEYL----------NIFLEGQNYVAGDHLTVADIAILSTVSTFEI-----FDFDL-NKYPNVAR 181
Fly 182 WYANA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD5 | NP_524914.3 | GstA | 1..184 | CDD:223698 | 48/196 (24%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 18/62 (29%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 26/122 (21%) | ||
clic2 | NP_001002561.2 | O-ClC | 11..238 | CDD:129941 | 48/199 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589553 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |