Sequence 1: | NP_524914.3 | Gene: | GstD5 / 48338 | FlyBaseID: | FBgn0010041 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002807.1 | Gene: | Clic1 / 406864 | RGDID: | 1303043 | Length: | 241 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 40/197 - (20%) |
---|---|---|---|
Similarity: | 77/197 - (39%) | Gaps: | 38/197 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 VIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD 79
Fly 80 DTLFPKDPKKQALVNQRLYFDMGTL-YDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLNIFL-- 141
Fly 142 -------------EG---QNYVAGDHLTVADIAILSTVSTFEIF-----DFDL-NKYPNVARWYA 184
Fly 185 NA 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD5 | NP_524914.3 | GstA | 1..184 | CDD:223698 | 38/193 (20%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 13/58 (22%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 25/124 (20%) | ||
Clic1 | NP_001002807.1 | Required for insertion into the membrane. /evidence=ECO:0000250 | 2..90 | 14/68 (21%) | |
O-ClC | 6..241 | CDD:129941 | 40/197 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166348211 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |