DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Clic1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001002807.1 Gene:Clic1 / 406864 RGDID:1303043 Length:241 Species:Rattus norvegicus


Alignment Length:197 Identity:40/197 - (20%)
Similarity:77/197 - (39%) Gaps:38/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD 79
            :.||....||..|:..::|..:.:   ...||.|...:|.|:.......::..|..:|      :
  Rat    30 LFMVLWLKGVTFNVTTVDTKRRTE---TVQKLCPGGQLPFLLYGTEVHTDTNKIEEFL------E 85

  Fly    80 DTLFPKDPKKQALVNQRLYFDMGTL-YDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLNIFL-- 141
            ..|.|....|.|.:|.    :..|. .|.|||:...:.::....:|...|.:..:.:.|:.:|  
  Rat    86 AVLCPPRYPKLAALNP----ESNTSGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTS 146

  Fly   142 -------------EG---QNYVAGDHLTVADIAILSTVSTFEIF-----DFDL-NKYPNVARWYA 184
                         ||   :.::.|:.||:||..:|..:...::.     .|.: ..:..|.|:.:
  Rat   147 PLPEEVDETSAEDEGISQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLS 211

  Fly   185 NA 186
            ||
  Rat   212 NA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 38/193 (20%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/58 (22%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/124 (20%)
Clic1NP_001002807.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 14/68 (21%)
O-ClC 6..241 CDD:129941 40/197 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.