DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gstt1b

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:226 Identity:61/226 - (26%)
Similarity:111/226 - (49%) Gaps:33/226 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            :|.:..|    ||:|.:.||...::.:.|.::..|..|...||.|:||....||:.|..|.:.||
Zfish     7 LDLFSQP----CRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAES 67

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAK-YYYPLFHTGKPGSDEDFKK 129
            .||.:||.:|:...|..||.|.:|:|.||:.|.:...::....|| .::.:......|::...:|
Zfish    68 VAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEK 132

  Fly   130 IESSFEYLNI--------FLEGQNYVAGDHLTVAD-IAILSTVSTF----EIFDFDLNKYPNVAR 181
            :|::.|.||:        ||:.:.::.||.:::|| :||:..:..|    ::|:           
Zfish   133 MENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFE----------- 186

  Fly   182 WYANAKKVTPGWEENWKGAVELKGVFDARQA 212
               |..|: ..|::..:.|:..|...:|.||
Zfish   187 ---NRPKL-KAWKDRVRVAIGAKLFDEAHQA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 53/196 (27%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/129 (21%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 56/210 (27%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 91..217 CDD:198292 31/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.