DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and gstt2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_956815.2 Gene:gstt2 / 393493 ZFINID:ZDB-GENE-040426-1617 Length:228 Species:Danio rerio


Alignment Length:228 Identity:63/228 - (27%)
Similarity:107/228 - (46%) Gaps:29/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEK------DQLKPEFVKLNPQHTIPTLVDNG 59
            :|....|    ||.|::..|      :.|:.:|:|:      :|..|||.||||...:|.|.|||
Zfish    11 LDLMSQP----CRAVLIFLK------HNKIPHTVEQIAIRKGEQKTPEFTKLNPMQKVPVLEDNG 65

  Fly    60 FSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQ-RLYFDMGTLYDSFAKYY----YPLFHTG 119
            |.:.||.||..||...|...|..:||.|:|:|.|:: ..:..|.|...:...::    .||. ||
Zfish    66 FVLTESDAILKYLATTYKVPDHWYPKLPEKRARVDEYTAWHHMNTRMHAATVFWQEVLLPLM-TG 129

  Fly   120 KPGSDEDFKK----IESSFEYL-NIFLEGQNYVAGDHLTVAD-IAILSTVSTFEIFDFDLNKYPN 178
            :|.:....:|    :..:.:.| |:||:.|.::.||.:::|| :||...:.........|...|.
Zfish   130 QPANTAKLEKALSDLSGTLDKLENMFLKRQAFLCGDDISLADLLAICELMQPMSSGRDILKDRPK 194

  Fly   179 VARWYANAKK-VTPGWEENWKGAVELKGVFDAR 210
            :..|.:..:. ::..::|.......|:..|.|:
Zfish   195 LLSWRSRVQSALSDSFDEAHTIVYRLRDKFTAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 59/199 (30%)
GST_N_Delta_Epsilon 1..74 CDD:239343 29/78 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/127 (20%)
gstt2NP_956815.2 GST_N_Theta 7..82 CDD:239348 29/80 (36%)
GST_C_Theta 95..220 CDD:198292 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589526
Domainoid 1 1.000 50 1.000 Domainoid score I11638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.