DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstO2

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:162 Identity:42/162 - (25%)
Similarity:70/162 - (43%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPEFVK-LNPQHTIPTLVDNGF----SIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYF 99
            |||:.| .:|...:|.|...|.    ::.||..||.||.::| ....|||.||.::||..     
  Fly    58 KPEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQY-PQTRLFPTDPLQKALDK----- 116

  Fly   100 DMGTLYDSFA---KYYYPLFHTGKPGSDED-FKKIESSFEYLNIFL--EGQNYVAGDHLTVADIA 158
               .|.:.||   ...||:. |..|.:.:| ....|::.:...:.|  .|..|.||.|:.:.|..
  Fly   117 ---ILIERFAPVVSAIYPVL-TCNPNAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYM 177

  Fly   159 I--------LSTVSTFEIFDFDLNKYPNVARW 182
            |        ...::|.:.::.|..::..:.:|
  Fly   178 IWPWFERFPSMKINTEQKYELDTKRFEKLLKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 42/162 (26%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/38 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/109 (20%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 13/37 (35%)
GstA 25..215 CDD:223698 42/162 (26%)
GST_C_Omega 110..235 CDD:198293 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.