DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and se

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:170 Identity:40/170 - (23%)
Similarity:69/170 - (40%) Gaps:39/170 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KPEF-VKLNPQHTIPTLV---DNGFSI-WESRAIAVYLVEKYGKDDTLFPKDPKKQA---LVNQR 96
            |||: ::.|||..:|.|.   :.|..: .||..|..||.|:|.. ..|:|:||.|:.   |:.:|
  Fly    57 KPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPL-RPLYPRDPLKKVQDKLLIER 120

  Fly    97 LYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLNIF-----LEGQNYVAGDHLTVAD 156
            ....:|.            |.....|.|     :|..:..|:|:     ..|..:..|:...:.|
  Fly   121 FRAVLGA------------FFKASDGGD-----LEPFWSGLDIYERELARRGTEFFGGEQTGILD 168

  Fly   157 IAI--------LSTVSTFEIFDFDLNKYPNVARWYANAKK 188
            ..|        |..:...|.:::|.:::|.:..|....|:
  Fly   169 YMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 39/164 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/38 (37%)
GST_C_Delta_Epsilon 88..204 CDD:198287 20/117 (17%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 13/37 (35%)
GstA 22..215 CDD:223698 40/170 (24%)
GST_C_Omega 109..229 CDD:198293 20/117 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.