DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstO3

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:189 Identity:48/189 - (25%)
Similarity:82/189 - (43%) Gaps:36/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MVAKALGVKLNMKLLNTLEKDQLKPEF-VKLNPQHTIPTL---VDNGF-SIWESRAIAVYLVEKY 76
            :|..|..|..:...:|..|    |||: |:::|...:|.|   .:.|. |:.||..||.||.:||
  Fly    38 LVLNAKNVPYHSVYINLTE----KPEWLVEVSPLLKVPALQLVAEKGEPSLIESLIIAEYLDDKY 98

  Fly    77 GKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLNIFL 141
             .::.|.||||.|:|  ..::..:.   :.|....:..:...|        ..:|..:..|:||.
  Fly    99 -PENPLLPKDPLKRA--QDKILLER---FSSITSAFINILVQG--------TGLEDYWTALDIFE 149

  Fly   142 E-----GQNYVAGDHLTVADIAI---LSTVSTFEI-----FDFDLNKYPNVARWYANAK 187
            |     |..|..|:.....|..|   ...:|..|:     ::|:.:::|.:.:|.|..|
  Fly   150 EELTKRGTPYFGGNKPGFVDYMIWPWFERLSVIELKLQKEYNFNESRFPKITKWIALLK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 46/184 (25%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/61 (33%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/113 (19%)
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274 19/60 (32%)
GstA 22..209 CDD:223698 48/189 (25%)
GST_C_Omega 109..230 CDD:198293 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.