DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstE11

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:218 Identity:77/218 - (35%)
Similarity:129/218 - (59%) Gaps:12/218 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAI 68
            ||:||...||.|::.|.|||::|:::|:|....:....||:|||.|||||.|.|||..:.:|..|
  Fly     8 YYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSDSHII 72

  Fly    69 AVYLVEKYGK--DDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPL--FHTGKPGSDEDFKK 129
            ..||.:||..  ||:|:||||:|:.||:.|||:|.|.|:........|:  |..|:..||. ...
  Fly    73 CSYLADKYAPEGDDSLYPKDPEKRRLVDARLYYDCGHLFPRIRFIVEPVIYFGAGEVPSDR-VAY 136

  Fly   130 IESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIF-DFDLNKYPNVARWYANAKKVTPGW 193
            ::.:::.|...|...:|:.||.||:||::.:::|||.|.| ..:.:::|.:.:|....:.: |.:
  Fly   137 LQKAYDGLEHCLAEGDYLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQWVKRIQAL-PYY 200

  Fly   194 EENWKGAVEL-----KGVFDARQ 211
            ::|.:..:::     ||:...||
  Fly   201 QKNNQEGLDMLVGLVKGLLAERQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 71/184 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 32/69 (46%)
GST_C_Delta_Epsilon 88..204 CDD:198287 32/123 (26%)
GstE11NP_001286575.1 GstA 5..198 CDD:223698 71/191 (37%)
GST_N_Delta_Epsilon 5..78 CDD:239343 32/69 (46%)
GST_C_Delta_Epsilon 94..211 CDD:198287 32/118 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460235
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.