DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstE8

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:195 Identity:75/195 - (38%)
Similarity:121/195 - (62%) Gaps:5/195 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |...:...|||:......:|||.|:.|.|||::.|||||:|||.|:|..||:|.||:.|||.|||
  Fly    16 RAAKLTLAALGIPYEYVKINTLAKETLSPEFLRKNPQHTVPTLEDDGHFIWDSHAISAYLVSKYG 80

  Fly    78 KDDTLFPKDPKKQALVNQRLYFDMGTLY-DSFAKYYYPLFHTGKPG-SDEDFKKIESSFEYLNIF 140
            :.|||:|||..::|:|:|||:|:.|.:: :.......|||.||:.. ..|.:..:...::::..|
  Fly    81 QSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETF 145

  Fly   141 LEGQNYVAGDHLTVADIAILSTVSTFEIF-DFDLNKYPNVARWYANAKKVTPGWEEN-WKGAVEL 203
            |.|.:::|||.||:||.:::::::...:| ..|..||.|:..|....::: |.:||. .|||.:|
  Fly   146 LTGHDFIAGDQLTIADFSLITSITALAVFVVIDTVKYANITAWIKRIEEL-PYYEEACGKGARDL 209

  Fly   204  203
              Fly   210  209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 68/173 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 29/60 (48%)
GST_C_Delta_Epsilon 88..204 CDD:198287 36/120 (30%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 68/180 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 29/60 (48%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/118 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460224
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.