DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstE4

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:194 Identity:71/194 - (36%)
Similarity:114/194 - (58%) Gaps:5/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |..::..|||.:......:|..||:....:|.|.|||||:|.|.|:...||:|.||..||||||.
  Fly    16 RACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACIWDSHAIMAYLVEKYA 80

  Fly    78 KDDTLFPKDPKKQALVNQRLYFDMGTLYDS-FAKYYYPLFHTGKPGSDED-FKKIESSFEYLNIF 140
            ..|.|:|||..::|.|:|.::|:.|.:::| ..:...|:...|:|....: ...|...::::..|
  Fly    81 PSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETF 145

  Fly   141 LEGQNYVAGDHLTVADIAILSTVSTFEIF-DFDLNKYPNVARWYANAKKVTPGWEE-NWKGAVE 202
            |:..::||||.||:||.:|:||:::..:| :.|..|||.:|.|....|:: |.:|| |.|||.:
  Fly   146 LDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL-PYYEEANGKGAAQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 63/173 (36%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/60 (40%)
GST_C_Delta_Epsilon 88..204 CDD:198287 38/119 (32%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 24/60 (40%)
GstA 6..196 CDD:223698 64/180 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460225
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.