DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstE10

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:225 Identity:78/225 - (34%)
Similarity:114/225 - (50%) Gaps:21/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYG 77
            |.|::..:||.:......|:....|.|||:.::.|||||:|.|.|....||:|.||..|||.||.
  Fly    16 RAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLVNKYA 80

  Fly    78 KDDTLFPKDPKKQALVNQRLYFDMGTLYDS-FAKYYYPLFHTGKPGSDED-FKKIESSFEYLNIF 140
            :.|.|:||||.|:|:|:|||:|:.|.|:.. |.:....||........:| ..:::.::..|..|
  Fly    81 QSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLAELKDAYALLEQF 145

  Fly   141 LEGQNYVAGDHLTVADIAILSTVSTFEI--FDFDLNKYPNVARWYANAKKVTPGWEENWKGAVEL 203
            |....||||..||:||.:|::||||..:  ...|..|||.::.|.|....:....|:|.:||..|
  Fly   146 LAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARISALPFYEEDNLRGARLL 210

  Fly   204 -----------------KGVFDARQAAAKQ 216
                             |...|.:..|.||
  Fly   211 ADKIRSKLPKQFDKLWQKAFEDIKSGAGKQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 67/174 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 24/60 (40%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/136 (29%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 68/180 (38%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/60 (40%)
GST_C_Delta_Epsilon 91..211 CDD:198287 39/119 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460223
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.