DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstT1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:216 Identity:59/216 - (27%)
Similarity:107/216 - (49%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFYYSPRGSGCRTVIMVAKALGVKLNMKLLNT---------LEKDQLKPEFVKLNPQHTIPTLVD 57
            ||...|           ::||.:.  |||..|         .:::||..|:..:|....:|.:||
  Fly    10 DFLSQP-----------SRALWIA--MKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVD 61

  Fly    58 NGFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRL---YFDMGTLYDSFAKYYYPLFHTG 119
            ..|.:.||.:|..||.:|....:.|:||..:::|.|::.|   :|::..:...|.:..:.|...|
  Fly    62 GKFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKG 126

  Fly   120 -----KPGSDED-FKKIESSFEYL-NIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLN--K 175
                 ||.|.:. .|.:||:...| .::|| ::::.||.||||||...|.::..::..:::|  :
  Fly   127 LAPAPKPESVKKLIKDVESNLGLLERLWLE-KDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQ 190

  Fly   176 YPNVARWYANAKKVT-PGWEE 195
            :|.||:|....:..| |.::|
  Fly   191 FPKVAKWMERVRDATNPYYDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 56/202 (28%)
GST_N_Delta_Epsilon 1..74 CDD:239343 22/80 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/121 (27%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/207 (27%)
GST_N_Theta 5..80 CDD:239348 22/82 (27%)
GST_C_Theta 93..218 CDD:198292 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.