DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstE13

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:213 Identity:70/213 - (32%)
Similarity:118/213 - (55%) Gaps:20/213 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIW-ESRA 67
            ||:......|..|:|||.:|:.|.:|.::..:|:.|..|||||||||.||..||:...:: :|.|
  Fly     7 YYALFSPPARACILVAKLIGLDLELKPVDFAKKEHLSEEFVKLNPQHQIPVFVDSDGEVYVDSHA 71

  Fly    68 IAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLY----DSFAKYYYPLFHTGKPGSDEDFK 128
            |..:||.||..:|.|:|:|.|::|.::.|::::.|.|:    |..|:..|        |.:.::.
  Fly    72 IVCFLVAKYAGNDQLYPRDLKRRAHIDHRMHYENGVLFQVVKDIVARNIY--------GGEGEYN 128

  Fly   129 K-----IESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTFE-IFDFDLNKYPNVARWYANAK 187
            .     ..:::..|..||:..::|.|:.|:|||::|.:|:.|.: :...:..|||...:|.....
  Fly   129 PRSLTLCHNAYSDLEHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQWMERMD 193

  Fly   188 KVTPGWEE-NWKGAVELK 204
            |:.|..|| |.|||..|:
  Fly   194 KLLPDNEEINLKGARALQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 61/190 (32%)
GST_N_Delta_Epsilon 1..74 CDD:239343 29/70 (41%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/126 (26%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343 29/70 (41%)
GST_C_Delta_Epsilon 92..211 CDD:198287 33/126 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460229
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.