DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and clic1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_997847.1 Gene:clic1 / 324481 ZFINID:ZDB-GENE-030131-3202 Length:241 Species:Danio rerio


Alignment Length:165 Identity:34/165 - (20%)
Similarity:66/165 - (40%) Gaps:32/165 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VIMVAKALGVKLNMKLLNTLEKDQLKPEFVK-LNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGK 78
            :.||....||..|:..::.    :.|||.:| |.|....|.|:.......::..|..:|      
Zfish    30 LFMVLWLKGVTFNVTTVDM----KRKPEILKDLAPGAQPPFLLYGTEVKTDTNKIEEFL------ 84

  Fly    79 DDTLFPKDPKKQALVN---QRLYFDMGTLYDSFAKYYYPLFHTG-KPGSDEDFKKIESSFEYL-- 137
            ::||.|....:.|..|   .....|:.:.:.::.|...|..:.. :.|..:..||::   :||  
Zfish    85 EETLCPPKYPRLAACNPESNTAGLDVFSKFSAYIKNSNPQMNDNLEKGLLKALKKLD---DYLSS 146

  Fly   138 ------------NIFLEGQNYVAGDHLTVADIAIL 160
                        ::....::::.|..||:||..:|
Zfish   147 PLPDEIDENSADDVISSTRSFLDGQELTLADCNLL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 34/165 (21%)
GST_N_Delta_Epsilon 1..74 CDD:239343 15/59 (25%)
GST_C_Delta_Epsilon 88..204 CDD:198287 16/91 (18%)
clic1NP_997847.1 GST_N_CLIC 3..93 CDD:239359 18/72 (25%)
O-ClC 6..241 CDD:129941 34/165 (21%)
GST_C_CLIC1 100..238 CDD:198333 15/85 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.