DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_038961050.1 Gene:Gdap1l1 / 311616 RGDID:1304960 Length:369 Species:Rattus norvegicus


Alignment Length:69 Identity:15/69 - (21%)
Similarity:31/69 - (44%) Gaps:10/69 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KIESSFEYLNIFLEGQN---YVAGDHLTVADIAILSTVSTFEIFDFDLNKY------PNVARWYA 184
            :||:..|...:..|||.   ::.|...|:||:.:.:|:...:..... .||      ||:..::.
  Rat   242 QIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQSFFE 305

  Fly   185 NAKK 188
            ..::
  Rat   306 RVQR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 15/63 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343
GST_C_Delta_Epsilon 88..204 CDD:198287 15/69 (22%)
Gdap1l1XP_038961050.1 Thioredoxin_like 47..122 CDD:412351
GST_C_family 203..313 CDD:413470 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.