powered by:
Protein Alignment GstD5 and Gdap1l1
DIOPT Version :9
Sequence 1: | NP_524914.3 |
Gene: | GstD5 / 48338 |
FlyBaseID: | FBgn0010041 |
Length: | 216 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038961050.1 |
Gene: | Gdap1l1 / 311616 |
RGDID: | 1304960 |
Length: | 369 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 15/69 - (21%) |
Similarity: | 31/69 - (44%) |
Gaps: | 10/69 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 KIESSFEYLNIFLEGQN---YVAGDHLTVADIAILSTVSTFEIFDFDLNKY------PNVARWYA 184
:||:..|...:..|||. ::.|...|:||:.:.:|:...:..... .|| ||:..::.
Rat 242 QIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQSFFE 305
Fly 185 NAKK 188
..::
Rat 306 RVQR 309
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166348201 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.