DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Clic4

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_038913.1 Gene:Clic4 / 29876 MGIID:1352754 Length:253 Species:Mus musculus


Alignment Length:178 Identity:35/178 - (19%)
Similarity:67/178 - (37%) Gaps:63/178 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALV 93
            |:...||:....|:::||:|:|.            ||....:.:..|:    :.:.|:.:.:|  
Mouse    90 KIEEFLEEVLCPPKYLKLSPKHP------------ESNTAGMDIFAKF----SAYIKNSRPEA-- 136

  Fly    94 NQRLYFDMGTLYDSFAKYYYPLFHTGKPGSDEDFKKIESSFEYLN--------------IFLEGQ 144
            |:.|  :.|.|                       |.::...||||              |....:
Mouse   137 NEAL--ERGLL-----------------------KTLQKLDEYLNSPLPDEIDENSMEDIKFSTR 176

  Fly   145 NYVAGDHLTVADIAILSTVSTFEIF-----DFDLNK-YPNVARWYANA 186
            .::.||.:|:||..:|..:...::.     :||:.| ...:.|:..||
Mouse   177 RFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNA 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 33/174 (19%)
GST_N_Delta_Epsilon 1..74 CDD:239343 10/44 (23%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/119 (19%)
Clic4NP_038913.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 3/10 (30%)
O-ClC 17..252 CDD:129941 35/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.