DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Clic3

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001013098.2 Gene:Clic3 / 296566 RGDID:1307249 Length:237 Species:Rattus norvegicus


Alignment Length:182 Identity:40/182 - (21%)
Similarity:64/182 - (35%) Gaps:62/182 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKY 76
            |:.:.||....||...:..::|.....:..:|.   |...:|.|:.:|....::..|..:|.|..
  Rat    26 CQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEEFLEETL 87

  Fly    77 GKDD----------------------TLFPKDP---KKQALVNQ------RLYFDMGTLYDSFAK 110
            |..|                      :.|.|:|   :..||..|      ||...:||       
  Rat    88 GPPDFPGLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDDALYQQLLRALTRLDRYLGT------- 145

  Fly   111 YYYPLFH--TGKPGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAIL 160
               ||.|  ..:|...|..::          ||:      ||.||:||.::|
  Rat   146 ---PLDHELAQEPHLSESRRR----------FLD------GDQLTLADCSLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 40/182 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 13/61 (21%)
GST_C_Delta_Epsilon 88..204 CDD:198287 21/81 (26%)
Clic3NP_001013098.2 O-ClC 6..230 CDD:129941 40/182 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.