DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTZ1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:189 Identity:58/189 - (30%)
Similarity:83/189 - (43%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSPRGSGCRTVIMVAKAL-GVKLNMKLLNTLEKD---QLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ||...|.|...:.:|.|| |:......:| |.||   |...:|..|||...:|||..:|.:|.:|
Human    10 YSYFRSSCSWRVRIALALKGIDYETVPIN-LIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQS 73

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFHTG---KPGSDEDF 127
            .||..|| |:......|.|:||||:|.|..        :.|..|....||.:..   :.|.:...
Human    74 LAIIEYL-EEMRPTPRLLPQDPKKRASVRM--------ISDLIAGGIQPLQNLSVLKQVGEEMQL 129

  Fly   128 ----KKIESSFEYLNIFLEGQN--YVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVA 180
                ..|...|..|...|:...  |..||.:|:||:.::..|:..|.|..||..||.::
Human   130 TWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTIS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 58/189 (31%)
GST_N_Delta_Epsilon 1..74 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 88..204 CDD:198287 26/102 (25%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 58/189 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.