DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTT1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_000844.2 Gene:GSTT1 / 2952 HGNCID:4641 Length:240 Species:Homo sapiens


Alignment Length:197 Identity:48/197 - (24%)
Similarity:99/197 - (50%) Gaps:20/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ::.|.......||.|.:.||...:...:::::.::...|...|.::||...:|.|.|..|::.||
Human     3 LELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTES 67

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDS-----FAKYYYPLFHTGKPGSDE 125
            .||.:||..||...|..:|:|.:.:|.|::.|.:...||..|     :.|..:|:| .|:|.|.:
Human    68 VAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVF-LGEPVSPQ 131

  Fly   126 ----DFKKIESSFEYL-NIFLEGQNYVAGDHLTVADIAILSTV-----STFEIFDFDLNKYPNVA 180
                ...:::.:.:.| :.||:.:.::.|.|:::||:..::.:     :..::|:    ..|.:|
Human   132 TLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFE----GRPKLA 192

  Fly   181 RW 182
            .|
Human   193 TW 194

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 48/197 (24%)
GST_N_Delta_Epsilon 1..74 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/110 (21%)
GSTT1NP_000844.2 GST_N_Theta 3..78 CDD:239348 20/74 (27%)