DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Eef1g

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001004223.1 Gene:Eef1g / 293725 RGDID:1302939 Length:437 Species:Rattus norvegicus


Alignment Length:189 Identity:43/189 - (22%)
Similarity:88/189 - (46%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEFVKLNPQHTIPTLV-DNGFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTL 104
            |||::..|...:|... |:||.::||.|||.|:     .::.|....|:..|.|.|.:.|....:
  Rat    47 PEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV-----SNEELRGSTPEAAAQVVQWVSFADSDI 106

  Fly   105 YDSFAKYYYP---LFHTGKPGSDEDFKKIESSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTF 166
            ....:.:.:|   :.|..|..::...::::.....|:..|:.:.::.|:.:|:|||.::.|:...
  Rat   107 VPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWL 171

  Fly   167 --EIFDFDLNK-YPNVARWYANAKKVTPGWEENWK---GAVEL---KGVFDARQAAAKQ 216
              ::.:....: :||..||:.....     :..::   |.|:|   ...|||::.|..|
  Rat   172 YKQVLEPSFRQAFPNTNRWFLTCIN-----QPQFRAILGEVKLCEKMAQFDAKKFAESQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 35/149 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/33 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 22/127 (17%)
Eef1gNP_001004223.1 GST_N_EF1Bgamma 4..82 CDD:239342 14/39 (36%)
maiA 5..187 CDD:273527 32/144 (22%)
GST_C_EF1Bgamma_like 91..213 CDD:198290 22/126 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..268 2/5 (40%)
EF1G 275..381 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.