DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GSTT4

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:238 Identity:55/238 - (23%)
Similarity:99/238 - (41%) Gaps:60/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65
            ||...:|    ||.|.:.:|...::.|.:.::.|:.......::.:||...:|:|.|..|.:.||
Human     7 MDLLSAP----CRAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSLKDGKFILSES 67

  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKYYYPLFH------------- 117
            .||..||..||.......|.||..:|.|            |.|..:.:..|.             
Human    68 AAILYYLCRKYSAPSHWCPPDPHARARV------------DEFVAWQHTAFQLPMKKIVWLKLLI 120

  Fly   118 ---TGKPGSDEDF----KKIESSFE-YLNIFLEGQNYVAGDHLTVADIAILSTVSTFEIFDFDLN 174
               ||:..|.|..    :::::|.: :...||:.:.::.|:.:::||:     |:..|:..    
Human   121 PKITGEEVSAEKMEHAVEEVKNSLQLFEEYFLQDKMFITGNQISLADL-----VAVVEMMQ---- 176

  Fly   175 KYPNVARW--YANAKKVTPGWEENWKGAVEL---KGVFDARQA 212
              |..|.:  :.|:.|:.     .|:..|||   .|:|  |:|
Human   177 --PMAANYNVFLNSSKLA-----EWRMQVELNIGSGLF--REA 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 45/205 (22%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/141 (18%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 21/74 (28%)