| Sequence 1: | NP_524914.3 | Gene: | GstD5 / 48338 | FlyBaseID: | FBgn0010041 | Length: | 216 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_445744.1 | Gene: | Vars1 / 25009 | RGDID: | 3950 | Length: | 1264 | Species: | Rattus norvegicus |
| Alignment Length: | 202 | Identity: | 48/202 - (23%) |
|---|---|---|---|
| Similarity: | 73/202 - (36%) | Gaps: | 42/202 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 PQHTIPTLVD--NGFSIWESRAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAK 110
Fly 111 YYYPLFHTGKPGSDEDF------KKIESSFEYLNIFLEGQNYVAGDHLTVADI-AILSTVSTFE- 167
Fly 168 IFDFDLNK-YPNVARW-------------------YANAKKVT--PGWE--ENWKGAVELKGVFD 208
Fly 209 ARQAAAK 215 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GstD5 | NP_524914.3 | GstA | 1..184 | CDD:223698 | 35/165 (21%) |
| GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 8/27 (30%) | ||
| GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 34/147 (23%) | ||
| Vars1 | NP_445744.1 | GstA | <56..203 | CDD:223698 | 34/154 (22%) |
| GST_C_family | 92..213 | CDD:295467 | 26/124 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 218..296 | 9/29 (31%) | |||
| PTZ00419 | 282..1264 | CDD:240411 | |||
| ValRS_core | 335..938 | CDD:185677 | |||
| 'HIGH' region | 344..354 | ||||
| tRNA-synt_1_2 | 513..640 | CDD:290334 | |||
| 'KMSKS' region | 862..866 | ||||
| Anticodon_Ia_Val | 938..1075 | CDD:153416 | |||
| Val_tRNA-synt_C | 1196..1258 | CDD:287436 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||