DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and GstE9

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:211 Identity:75/211 - (35%)
Similarity:114/211 - (54%) Gaps:12/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAV 70
            ||....|:   :...|||::...:|:|.|..:....||...|||||:|.|.|:|..||||.||..
  Fly    12 SPPVRACK---LTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKFIWESHAICA 73

  Fly    71 YLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDS-FAKYYYPLFH---TGKPGSDEDFKKIE 131
            |||.:|.|.|.|:|||..|:|||:|||:|:.|.|:.. ......|||:   |..|.|..|  .|.
  Fly    74 YLVRRYAKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIAIPLFYKNITEVPRSQID--AIY 136

  Fly   132 SSFEYLNIFLEGQNYVAGDHLTVADIAILSTVSTF-EIFDFDLNKYPNVARWYANAKKVTPGWEE 195
            .::::|..|:..|.|:.|..:|:||.:::|:||:. .:...|..:||.:..| .:.....|.::.
  Fly   137 EAYDFLEAFIGNQAYLCGPVITIADYSVVSSVSSLVGLAAIDAKRYPKLNGW-LDRMAAQPNYQS 200

  Fly   196 -NWKGAVELKGVFDAR 210
             |..||..|..:|.::
  Fly   201 LNGNGAQMLIDMFSSK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 69/182 (38%)
GST_N_Delta_Epsilon 1..74 CDD:239343 28/67 (42%)
GST_C_Delta_Epsilon 88..204 CDD:198287 37/121 (31%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 70/194 (36%)
GST_N_Delta_Epsilon 4..76 CDD:239343 27/66 (41%)
GST_C_Delta_Epsilon 92..209 CDD:198287 37/119 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460227
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.