DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstD5 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:263 Identity:44/263 - (16%)
Similarity:89/263 - (33%) Gaps:83/263 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLV--DNGFSIWESR 66
            |:..:....:.|.:|....|:....:.::..:.:..:|.|::||....:|.::  ||..|.::. 
Mouse    50 YHWTQSFSSQKVRLVIAEKGLACEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQ- 113

  Fly    67 AIAVYLVEKYGKDD--TLFPK--DPKKQALVNQR----------------LYFDMGTLYDSFAKY 111
             |..|:...:..:.  .|.|:  .|:...::..|                |:.::.|  ||....
Mouse   114 -IIDYVERTFTGEHVVALMPEAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTT--DSMIPK 175

  Fly   112 Y----------------YPLFHTGKPGSDEDF--------------------KK----------- 129
            |                ..|.|..:|...|.:                    ||           
Mouse   176 YATAEIRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ 240

  Fly   130 IESSFEYLNIFLEGQN---YVAGDHLTVADIAILSTVSTFEIFDFDLNKY------PNVARWYAN 185
            ||:..|...:..|||.   ::.|...|:||:.:.:|:...:..... .||      ||:..::..
Mouse   241 IEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGLS-KKYWEDGSRPNLQSFFER 304

  Fly   186 AKK 188
            .::
Mouse   305 VQR 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstD5NP_524914.3 GstA 1..184 CDD:223698 44/257 (17%)
GST_N_Delta_Epsilon 1..74 CDD:239343 14/71 (20%)
GST_C_Delta_Epsilon 88..204 CDD:198287 27/173 (16%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 44/263 (17%)
GST_N_GDAP1 47..119 CDD:239350 14/70 (20%)
GST_C_family 201..311 CDD:295467 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844749
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.