Sequence 1: | NP_524914.3 | Gene: | GstD5 / 48338 | FlyBaseID: | FBgn0010041 | Length: | 216 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659140.2 | Gene: | Gdap1l1 / 228858 | MGIID: | 2385163 | Length: | 367 | Species: | Mus musculus |
Alignment Length: | 263 | Identity: | 44/263 - (16%) |
---|---|---|---|
Similarity: | 89/263 - (33%) | Gaps: | 83/263 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 YYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLV--DNGFSIWESR 66
Fly 67 AIAVYLVEKYGKDD--TLFPK--DPKKQALVNQR----------------LYFDMGTLYDSFAKY 111
Fly 112 Y----------------YPLFHTGKPGSDEDF--------------------KK----------- 129
Fly 130 IESSFEYLNIFLEGQN---YVAGDHLTVADIAILSTVSTFEIFDFDLNKY------PNVARWYAN 185
Fly 186 AKK 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstD5 | NP_524914.3 | GstA | 1..184 | CDD:223698 | 44/257 (17%) |
GST_N_Delta_Epsilon | 1..74 | CDD:239343 | 14/71 (20%) | ||
GST_C_Delta_Epsilon | 88..204 | CDD:198287 | 27/173 (16%) | ||
Gdap1l1 | NP_659140.2 | GstA | 47..314 | CDD:223698 | 44/263 (17%) |
GST_N_GDAP1 | 47..119 | CDD:239350 | 14/70 (20%) | ||
GST_C_family | 201..311 | CDD:295467 | 19/108 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844749 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |